PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG023727.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family TCP
Protein Properties Length: 199aa    MW: 21455 Da    PI: 6.8014
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG023727.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP108.97.5e-3453118671
          TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 
                  ++++++hTkv+gR+RRvR++a++aar+F+L++eLG+ +d++tieWLl++a+++i+++tgt+++++ 
  CCG023727.1  53 SQSKDRHTKVNGRGRRVRMPALTAARVFQLTRELGHRSDGETIEWLLRNAEASIIAATGTGTIPSI 118
                  678*********************************************************988883 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-2854122IPR005333Transcription factor, TCP
PROSITE profilePS5136926.99455109IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MVLDNLSSTS NNQQKQQQNS NLNNNNHVVP TTIPAASSGS DSKLAHPRKS TASQSKDRHT  60
KVNGRGRRVR MPALTAARVF QLTRELGHRS DGETIEWLLR NAEASIIAAT GTGTIPSIPI  120
STTVGPAPIS ASPPSVSGEV HPAIDTGPDV FSLTEASCRL DLDYRHMPFT ALLLKPLSEN  180
VDLEAEEGRQ EEVIGEQKM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011018727.11e-146PREDICTED: transcription factor TCP11
TrEMBLB9MTE01e-127B9MTE0_POPTR; Uncharacterized protein
STRINGPOPTR_0006s12770.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.16e-31TCP family protein